PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG002532t2
Common NameTCM_002532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 1159aa    MW: 130893 Da    PI: 8.077
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG002532t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.25e-12554857
                      -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      ++ ql++Le+++e+++yp+++++e  A+ lgLt + Vk WF  rR ++k+
  Thecc1EG002532t2  5 SSLQLQALESFYEEEKYPTQRQMEGYAAALGLTLKEVKGWFVERRRRDKR 54
                      678*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.3E-9159IPR001356Homeobox domain
PROSITE profilePS5007114.058155IPR001356Homeobox domain
CDDcd000861.33E-10354No hitNo description
Gene3DG3DSA:1.10.10.603.7E-12354IPR009057Homeodomain-like
SuperFamilySSF466892.87E-11359IPR009057Homeodomain-like
PfamPF000462.0E-9554IPR001356Homeobox domain
SMARTSM005716.8E-10381440IPR018501DDT domain
PROSITE profilePS5082712.413381440IPR018501DDT domain
PfamPF027915.6E-10383437IPR018501DDT domain
PfamPF156121.0E-7662701IPR028942WHIM1 domain
PfamPF156131.1E-11794867IPR028941WHIM2 domain
Gene3DG3DSA:3.90.10.103.0E-49541004No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1159 aa     Download sequence    Send to blast
MKRKSSLQLQ ALESFYEEEK YPTQRQMEGY AAALGLTLKE VKGWFVERRR RDKRDYGIML  60
PIHSMKKLHA PNARNVGGVS AGRKNPKGQG SLFHNRSNTG AALCSRYKSA FSTANKRKKK  120
MLLLQDLSSP QYILKKVFRK DGPPLGVEFD SLPSQAFCHC KGSKNSHPAD QEDQRATRRR  180
TVSELTTIDY QNNCNESAPV KKHGIGKGLM TVWRVVNPEG GDIPTGVDFS NKQIIAPPQT  240
SSPVVRKPPA RNKRRQPLVS LMKQRSLEKK LQEKKRPSIK RREMKSNKDD SNRQLHKEKC  300
ELALEGSTSN KSLDQLLMLV DDEELELREL QAGPNPLTCS DHLGTSGVLG CSLCKDLLAK  360
FPPSSVKMKQ PFSMQPWDSS PDTVKKLFKV FHFLYTYSVT LDICSFTLDE FAQAFHDKDS  420
LLLGKIHVAL LQLLLSDVKL ELSGVLLPHF GLSCKFLALL HSVENQEFVV EFWKTSLNPL  480
TWTEILRQVL VAAGFGSKQG LLRREALSKE MSLMARYGLR PGSLKGELFR ILSERGNNGL  540
KVSDLAKSLP VTELNLTSTT EELEELICST LSSDITLFEK ISSSAYRLRS NSVAKEGNDF  600
HSDTEDSGSV DDDTDDSSAS SSSEDSDCDL GNYYQRKLKH KNYRKSKNNM MTVYTEIDES  660
HPGEVWLLGL MEGEYSDLSI EEKLNALVAL IDLLRAGSSV RMENPSEVIA ECVPNIPHYG  720
SGAKIKRSSN QHNFPRPSWV YGGPKNGVQE AHTSSDSHPL DSSSILKFCE KEKCPSSRMD  780
AKETQTGVDI HPMQSIFLGS DRRYNRYWLF LGPCNAYDPG HRRIYYESSE DGHWEVIDTE  840
EALRALLAVL DDRGKREALL IESLEKREAS LCQEMSTRHL YDAGIRRMPS ESPELDLVRE  900
DSSSPVSDVD NNLSLTIAMN ESLTPFGAIV LEAGKKGEEQ NRKWRRLQEF DMWIWKCFYL  960
KLNAVKYSKR SYLDSLNRCE SCHDLYWRDE KHCKICHTTF ELDFDLEERY AIHVATCREK  1020
GDNSMFPKFK VLSSQLQSLK AAVHAIESVM PEGALVGAWT KSAHRLWVKR LRRTSSLSEL  1080
LQVVADFVAA INENWLNQCN TDQGGCAVIE EIIAFFPTIP QTSSAVALWL VKLDEFIAPY  1140
LRKVHSKKEL ENGTRCSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14651ERRRRD
24752RRRRDK
34754RRRRDKRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007049488.10.0Homeodomain-like transcriptional regulator isoform 2
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLA0A061DLT60.0A0A061DLT6_THECC; Homeodomain-like transcriptional regulator isoform 2
STRINGVIT_19s0085g00350.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]